PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.8G086100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GATA
Protein Properties Length: 324aa    MW: 35245.4 Da    PI: 5.934
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.8G086100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.81.5e-18242275134
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                         Cs+C++ kTp+WR gp g ktLCnaCG+++++ +
  Prupe.8G086100.1.p 242 CSHCHVQKTPQWRTGPLGAKTLCNACGVRFKSGR 275
                         *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169929.1E-8419316IPR016679Transcription factor, GATA, plant
SMARTSM004011.6E-14236290IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.19E-13236297No hitNo description
PROSITE profilePS5011411.253240272IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.102.5E-14240273IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.96E-14241290No hitNo description
PfamPF003202.1E-16242275IPR000679Zinc finger, GATA-type
PROSITE patternPS003440242267IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MELCTKALKS SLRRELTLKS NQQALIDEFW CATGISGVPS EDFSVDDLLD LSNGEFEDGS  60
VEEEEEEEKD SVSVDDESSN SSNFVSADSE SALASQLLVP DDDLAGLEWV SHFADDSLLD  120
LSLLHPVGTQ KPEALALTPS EPEAKPVQSR PTWFPKQVPV KPRSKRCRPA SRVWSYPSSS  180
SPSSSSSCSS GFSFSTPCLI FNNPVHSADV FVGEPATKKQ KKKPAVQTGV DGSVGVQFQR  240
RCSHCHVQKT PQWRTGPLGA KTLCNACGVR FKSGRLFPEY RPACSPTFSG DVHSNSHRKV  300
LEMRKRKEAG GPEPGLNRVI PSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008236855.10.0PREDICTED: GATA transcription factor 5-like
RefseqXP_008236856.10.0PREDICTED: GATA transcription factor 5-like
TrEMBLM5W4L41e-175M5W4L4_PRUPE; Uncharacterized protein
STRINGPOPTR_0009s12620.11e-102(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.28e-51GATA transcription factor 5